PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000045G1330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 336aa    MW: 37271.8 Da    PI: 9.0631
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000045G1330genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.4e-2488132145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  PH01000045G1330  88 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 132
                      79****************************************986 PP

2QLQ62.71e-211549236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++i+
  PH01000045G1330 15 VFTAAQWAELEQQALIYKYLMAGAPVPPDLLLPIR 49
                     5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-111450IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4331550IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.2E-161649IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34688132IPR014977WRC domain
PfamPF088793.8E-2189131IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGMGGYHHQQ QRAAVFTAAQ WAELEQQALI YKYLMAGAPV PPDLLLPIRP HSAAAAATFS  60
FANPAASPFY HHHHPSLSYY AYYGKKLDPE PWRCRRTDGK KWRCSKEAHP DSKYCERHMH  120
RGRNRSRKPV ESKTATPAPA PQPQPQLSTV TTTTSGYSLG AKVDVGELSF FSGASGNTRG  180
FTIDSPTDSS WHSLPSSVPP YPLSKTRDSG LLPGAYSYSH LEPSQELGQV TIASLSQEQE  240
RHSFSGGTGG LLGNVKQENQ PLRPFFDEWP GTRDSWSEMD DERSNRTSFS TTQLSISIPM  300
PRCGSPIYLK RLRMYLFACP RHGMSHGDYS PHLLC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3764041e-156AK376404.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122P12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641603.10.0PREDICTED: growth-regulating factor 5 isoform X2
RefseqXP_015641604.10.0PREDICTED: growth-regulating factor 5 isoform X3
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLA0A0E0L7330.0A0A0E0L733_ORYPU; Uncharacterized protein
STRINGORGLA06G0010200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-28growth-regulating factor 5